NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224545_1024215

Scaffold Ga0224545_1024215


Overview

Basic Information
Taxon OID3300022881 Open in IMG/M
Scaffold IDGa0224545_1024215 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)872
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3533Long. (o)19.0471Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052060Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0224545_10242151F052060N/AMRKLRYFRVFLLLVGVMFPAYARAQEDNTVSLGDLARSLRQSKTPKQPAAAEIIDNDNLSQVIDDVEHFRQDGKPIFSFDSAGTNFRMSSPDGTCSLSFNANATALLSSPYVSQDLPPSELAKLDGPANIHGDTLEVSVYNASAWNLKEITVGLTIVRPRDTVAANPEAAKLLAVVAQDVAPDKDTP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.