Scaffold Ga0224553_1009072

Overview

Basic Information

• Taxon OID: 3300022875
• Scaffold ID: Ga0224553_1009072
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2886
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3532
  • Long. (^o): 19.0474
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012743	Metagenome	277	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0224553_10090722	F012743	GGAG	MIGPLAGLADDVFGLFARYSGGLFGKKAPEYEGRYGGTFGSPEFFQDAQAGDYRALARLEKEGYGPAWNRPFLRGTVEKEITRNMARGKTWMPKGVMTGSRMYGYGKFADNLWGKQAKMGLTFGVPLTVLGVATAPKGEMIKRGAEGIGMLTGQAMGGAVGGLLFGMPGEIAGQIIVGTVGEKIGSTLKPIEDLGHQAYHLNFGGEYHDTEIAYTQRQRAIQEMSTSCLNARQWLGKEAVLFHS