Basic Information | |
---|---|
Taxon OID | 3300022873 Open in IMG/M |
Scaffold ID | Ga0224550_1015092 Open in IMG/M |
Source Dataset Name | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1092 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Norrbotten County, Stordalen Mire | |||||||
Coordinates | Lat. (o) | 68.3535 | Long. (o) | 19.0472 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025273 | Metagenome | 202 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0224550_10150921 | F025273 | AGGA | MARSGPASLRGRDEVAKMAEVYMRASGTAIREISITQRTPPLTGSVTGRTAAKDEAHIAVATAANSFIVVEANPLGCEVQIGERLSLRFHQGRASI |
⦗Top⦘ |