Scaffold Ga0224531_1000032

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224531_1000032

Scaffold Ga0224531_1000032

Overview

Basic Information
Taxon OID	3300022849 Open in IMG/M
Scaffold ID	Ga0224531_1000032 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T100
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	94064
Total Scaffold Genes	91 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	68 (74.73%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location Name	Sweden: Norrbotten County, Stordalen Mire
Coordinates	Lat. (^o)	68.3529	Long. (^o)	19.0475	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053735	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224531_100003235	F053735	GAGG	MKLQLSFAFALVLAILAGTLPMILGHGQAAPKVVLQSQFKLIPFPKPASLMPGERSCPFFLWTKDFTSEQRIGFNYVDKAGMAMSNTPVVTNVTIILDSKDSVPVATTDSPLGSNDKVWKINMSQDTYNANAKCLEGISVKNAH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.