Scaffold Ga0222656_1006412

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0222656_1006412

Scaffold Ga0222656_1006412

Overview

Basic Information
Taxon OID	3300022834 Open in IMG/M
Scaffold ID	Ga0222656_1006412 Open in IMG/M
Source Dataset Name	Saline water microbial communities from Ace Lake, Antarctica - #472
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2633
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Ace Lake
Coordinates	Lat. (^o)	-68.4725	Long. (^o)	78.188	Alt. (m)		Depth (m)	13
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078009	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222656_10064121	F078009	N/A	QTQLDRLKGLDADTDWLSEEIRRAEYVGLDVAELKDRFEKMSQIRSRMIEEYSK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.