Basic Information | |
---|---|
Taxon OID | 3300022768 Open in IMG/M |
Scaffold ID | Ga0242731_156035 Open in IMG/M |
Source Dataset Name | Microbial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S12 Version 2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 662 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Davies Reef, Great Barrier Reef, Australia | |||||||
Coordinates | Lat. (o) | -18.833 | Long. (o) | 147.683 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010384 | Metagenome / Metatranscriptome | 304 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0242731_1560351 | F010384 | GGA | MQPQLGIWKRLIRSLLVVDRFSLSWGSGRGLLEVYQGWTDAASAGDLEEVY |
⦗Top⦘ |