NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0242730_1076571

Scaffold Ga0242730_1076571


Overview

Basic Information
Taxon OID3300022765 Open in IMG/M
Scaffold IDGa0242730_1076571 Open in IMG/M
Source Dataset NameMicrobial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S11 Version 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)596
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Source Dataset Sampling Location
Location NameDavies Reef, Great Barrier Reef, Australia
CoordinatesLat. (o)-18.833Long. (o)147.683Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041044Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0242730_10765711F041044AGAAGGLFLTPIMPKRTEMALPVPTTWFLEMGPDMAMLFAPFRRTHQPLPVPAFLLMLSPEDIDGSDIMKLKVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.