NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222622_10342248

Scaffold Ga0222622_10342248


Overview

Basic Information
Taxon OID3300022756 Open in IMG/M
Scaffold IDGa0222622_10342248 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1040
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9201Long. (o)-106.9487Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006855Metagenome / Metatranscriptome363Y
F028206Metagenome / Metatranscriptome192Y

Sequences

Protein IDFamilyRBSSequence
Ga0222622_103422482F028206GAGMNDDGVVVDIVCEAGLLYLELANLSDRPALNVSCKFDPPLVDMQGRDVSKLALFRRVEFLGPRRQIRTLLDSTAGYFAREGASRVTVVVEFERPDETARSTTVSHDLAVFRELVFVA
Ga0222622_103422483F006855N/ALGRAKTKIRRAHCSVGAIRRARSRRVGRVIGQRPRPGAVKRRGFPVKLTVGRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.