Scaffold Ga0214917_10016019

Overview

Basic Information

• Taxon OID: 3300022752
• Scaffold ID: Ga0214917_10016019
• Source Dataset Name: Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6461
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (90.91%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 34.2611
  • Long. (^o): -83.95
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031457	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214917_100160194	F031457	AGGA	MTPDEMTGEELTRRRDHIDELGRKLKRGDITQEFYDEAFNEQYEIEKKYGLLRPGSWLWDEMLDDLNAYNIKKSQEVKE