Scaffold Ga0255028_111215

Overview

Basic Information

• Taxon OID: 3300022749
• Scaffold ID: Ga0255028_111215
• Source Dataset Name: Metatranscriptome of freshwater microbial communities from Pennsylvania, United States - DR:GLUT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 539
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 41.1553
  • Long. (^o): -78.3938

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020828	Metagenome / Metatranscriptome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255028_1112151	F020828	N/A	MEKLFWSQYTGTKHPMPLSDQLKQLVELHKAAEQAMKGFIVRLWPGDALPNSYFGLVTRLVDACPRLEVVKQPVCIEGARRAFARVKVQWAKLDAVKLIKEGPPEGKEHRHPEMYYEGVLKGARLVADECTKDVIFE