| Basic Information | |
|---|---|
| Taxon OID | 3300022748 Open in IMG/M |
| Scaffold ID | Ga0228702_1107198 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 649 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 33.9266 | Long. (o) | -83.4611 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047562 | Metagenome / Metatranscriptome | 149 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0228702_11071981 | F047562 | N/A | MPAVCPGSPLSDGSCATPDKTRPHRGAKARRAPCLVLANTLLVTSLLALAGCSTNPPAPVAADDVIGDYDNACLPEAAIMAQALRRNGIKARVLIISGDGWSHAVTAYQYPPGEGRIWCWDSDEQSVPVSARWTSSEILA |
| ⦗Top⦘ |