| Basic Information | |
|---|---|
| Taxon OID | 3300022732 Open in IMG/M |
| Scaffold ID | Ga0224569_100857 Open in IMG/M |
| Source Dataset Name | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2572 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Czech Republic: South Bohemian Region | |||||||
| Coordinates | Lat. (o) | 49.043 | Long. (o) | 13.6183 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056782 | Metagenome / Metatranscriptome | 137 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0224569_1008571 | F056782 | GAG | MHFAHVIRSRKVGAWVVLITLAILVTLIAAIFLQTRRSPKPLEMDELYGLLD |
| ⦗Top⦘ |