Basic Information | |
---|---|
Taxon OID | 3300022724 Open in IMG/M |
Scaffold ID | Ga0242665_10075957 Open in IMG/M |
Source Dataset Name | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 951 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Massachusetts | |||||||
Coordinates | Lat. (o) | 42.481016 | Long. (o) | -72.178343 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089214 | Metagenome / Metatranscriptome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0242665_100759571 | F089214 | N/A | TFGVPDEPQVSRCGSFRTRPELQLSLTKPKCREETIMFKSPLARTLLCLSVLTLIGIAALALGSRQDVITSADGRMAIATKGPSVLKPTDNSSDAGLKTIAGNLSTYPFGTFFCCYGYTVAEGGTNFPFQYWDAIAFTPSADATVTKIKASVGAFGGITSGFELSIHDDSSGVPGKCLRSFHFKTPPGYGQCCTLDVGNDKAGIPVTAGTQYWIVASTTAKDTNFLGGWAFNSTDMRLHTIAGWCKGPTTYCGSNSGKWIAGNNLVPGFAVLGN |
⦗Top⦘ |