Scaffold Ga0248483_170279

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0248483_170279

Scaffold Ga0248483_170279

Overview

Basic Information
Taxon OID	3300022691 Open in IMG/M
Scaffold ID	Ga0248483_170279 Open in IMG/M
Source Dataset Name	Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Colorado
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1739
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Cross-Czo Soil Depth Profiles

Source Dataset Sampling Location
Location Name	USA: South Carolina
Coordinates	Lat. (^o)	34.6074	Long. (^o)	-81.7228	Alt. (m)		Depth (m)	.6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010513	Metagenome / Metatranscriptome	303	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0248483_1702792	F010513	AGG	VFLACPNRCSTNRFELWNASVFVDETGRYLEYRTEEAALYRCTQCGSPALDLGEVSSAMQADREAEERTLEYACPNCEAMFSARAEQNPIVCPECGQTFVVNPG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.