NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0248483_155447

Scaffold Ga0248483_155447


Overview

Basic Information
Taxon OID3300022691 Open in IMG/M
Scaffold IDGa0248483_155447 Open in IMG/M
Source Dataset NameSoil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Colorado
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1796
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Cross-Czo Soil Depth Profiles

Source Dataset Sampling Location
Location NameUSA: South Carolina
CoordinatesLat. (o)34.6074Long. (o)-81.7228Alt. (m)Depth (m).6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002065Metagenome / Metatranscriptome597Y

Sequences

Protein IDFamilyRBSSequence
Ga0248483_1554472F002065GGAGGVEFMAKWNPLALKILMWVMGVLLVAGSASSFIGGSFFQFDSAWGVTAGVAGVAFGAGLMIAGFDPVANVSWVRGLIIYAILEIVWQIFNQITIGRFDIVAFIVGILVAVLVLVLYPNKPALWMQGGARGGARA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.