| Basic Information | |
|---|---|
| Taxon OID | 3300022691 Open in IMG/M |
| Scaffold ID | Ga0248483_120889 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Colorado |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 706 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Cross-Czo Soil Depth Profiles |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: South Carolina | |||||||
| Coordinates | Lat. (o) | 34.6074 | Long. (o) | -81.7228 | Alt. (m) | Depth (m) | .6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025546 | Metagenome | 201 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0248483_1208892 | F025546 | N/A | LAIFRDIMNVPDNRMELVLNQRSPHPPLDRAAVESILGRKMSVLVGFDDSRPEDSTLAGGLVLQHDPSSMVSRGATEIARVILASLKLDG |
| ⦗Top⦘ |