Scaffold Ga0236339_1185375

Overview

Basic Information

• Taxon OID: 3300022650
• Scaffold ID: Ga0236339_1185375
• Source Dataset Name: Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Laval University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 869
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location

• Location Name: SAS2a, Kuujjuarapick, Canada
• Coordinates
  • Lat. (^o): 55.1491
  • Long. (^o): -77.4866

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040697	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0236339_11853753	F040697	N/A	TMQFANGMKDDEMMDGILKEAADGYGDLIAEALVHNVALKSLEMRVKELRLLRVAWIS