Basic Information | |
---|---|
Taxon OID | 3300022650 Open in IMG/M |
Scaffold ID | Ga0236339_1134026 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Laval University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2248 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | SAS2a, Kuujjuarapick, Canada | |||||||
Coordinates | Lat. (o) | 55.1491 | Long. (o) | -77.4866 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077976 | Metagenome | 117 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0236339_11340265 | F077976 | GGA | MAHQSESGRNRNERQEHDRKARSYEETTGNPYHLSKAARTVVGVLAAIVLITLTGLFVSGSIHW |
⦗Top⦘ |