| Basic Information | |
|---|---|
| Taxon OID | 3300022602 Open in IMG/M |
| Scaffold ID | Ga0248169_126628 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | U.S. Department of Energy (DOE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3228 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Trout Bog Lake, Vilas County, Wisconsin, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Trout Bog, Vilas County, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 46.0412 | Long. (o) | -89.6861 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048059 | Metagenome | 148 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0248169_1266282 | F048059 | GGGGG | MQALDKRTLKRELKLFLADKDRGISIKNFCEIAGISERLFLLVVKEGKAPMTESCQRGLNRAYMHWKEGKIRVMKKHTNETYPDYKKEPAPPIIPMNKLVFTNGEFKVQSKPLNRHDYSNFDNILLTRG |
| ⦗Top⦘ |