Scaffold Ga0248169_105414

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0248169_105414

Scaffold Ga0248169_105414

Overview

Basic Information
Taxon OID	3300022602 Open in IMG/M
Scaffold ID	Ga0248169_105414 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	U.S. Department of Energy (DOE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12702
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (35.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Trout Bog Lake, Vilas County, Wisconsin, United States

Source Dataset Sampling Location
Location Name	Trout Bog, Vilas County, Wisconsin, USA
Coordinates	Lat. (^o)	46.0412	Long. (^o)	-89.6861	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022821	Metagenome / Metatranscriptome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0248169_1054146	F022821	AGGA	MSYIVESDVIIRAVDKPFPNRVVMGVFTTAEMAYHFIEKYLADTKDLHTYFARQNICSKEEYESFISGERIVAFNIVLGQFEDMIYVRKE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.