NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0215182_1084294

Scaffold Ga0215182_1084294


Overview

Basic Information
Taxon OID3300022600 Open in IMG/M
Scaffold IDGa0215182_1084294 Open in IMG/M
Source Dataset NameMetatranscriptome of coral microbial communities from Popa Island, Bocas del Toro, Panama - APAL C3 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)593
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location NamePanama: Bocas del Toro
CoordinatesLat. (o)9.1956Long. (o)-82.1254Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004690Metagenome / Metatranscriptome427Y

Sequences

Protein IDFamilyRBSSequence
Ga0215182_10842941F004690N/AESSSNHDIFFTEDAAKKFFPTSKISAQEIRHQFCLIWSNLTIMAHMMGLGNPSESWKIIILS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.