Scaffold Ga0215185_1043563

Overview

Basic Information

• Taxon OID: 3300022597
• Scaffold ID: Ga0215185_1043563
• Source Dataset Name: Metatranscriptome of coral microbial communities from Popa Island, Bocas del Toro, Panama - APAL T3 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4603
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location

• Location Name: Panama: Bocas del Toro
• Coordinates
  • Lat. (^o): 9.1956
  • Long. (^o): -82.1254
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001506	Metagenome / Metatranscriptome	681	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0215185_10435636	F001506	N/A	MNQIHYQNRCRCNEEFSIAKKRKSVTRSEGKPIQYPNPELEEIFSKTFQIKYEKKLSLIAKLVLNSFQNKYIYYAIDDILYLFELNQNERENLLAILYSPILSLQNNYSVNFFDIWVKEIYIDEVFKANKFLSTDSQTSKQFSYITIKLFYKTRVPLKKQEALW