| Basic Information | |
|---|---|
| Taxon OID | 3300022595 Open in IMG/M |
| Scaffold ID | Ga0215184_1106553 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of coral microbial communities from Popa Island, Bocas del Toro, Panama - APAL T2 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 595 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Panama: Bocas del Toro | |||||||
| Coordinates | Lat. (o) | 9.1956 | Long. (o) | -82.1254 | Alt. (m) | Depth (m) | 15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004725 | Metagenome / Metatranscriptome | 426 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0215184_11065531 | F004725 | N/A | MATSAPLLGKAAHSKASIFYGADEYLEELKKKYQHDHEIAALKNALPGEGDPNAAGVAQSNDKMLSVQKNDENRSLKTNRLFPTPNKPDPMPQNLAFLFTKITPEQMIYMWNVLTAIFCTQVLMVIGYCAALACLPDYWCTCTLCFGIPFSYIAIQNIYIDHDVMHGATFPVYEWQRF |
| ⦗Top⦘ |