Basic Information | |
---|---|
Taxon OID | 3300022595 Open in IMG/M |
Scaffold ID | Ga0215184_1096722 Open in IMG/M |
Source Dataset Name | Metatranscriptome of coral microbial communities from Popa Island, Bocas del Toro, Panama - APAL T2 (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 910 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Panama: Bocas del Toro | |||||||
Coordinates | Lat. (o) | 9.1956 | Long. (o) | -82.1254 | Alt. (m) | Depth (m) | 15 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022326 | Metagenome / Metatranscriptome | 214 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0215184_10967221 | F022326 | GAG | MTIEKPKPKQLLRPITTGTNSFMNQSQFLAITCNSPEAREKSRVHGKIGFGFGFGFEKVARVF |
⦗Top⦘ |