| Basic Information | |
|---|---|
| Taxon OID | 3300022592 Open in IMG/M |
| Scaffold ID | Ga0236342_1031840 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Laval University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1322 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | SAS2a, Kuujjuarapick, Canada | |||||||
| Coordinates | Lat. (o) | 55.1491 | Long. (o) | -77.4866 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081327 | Metagenome / Metatranscriptome | 114 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0236342_10318403 | F081327 | AGGTGG | MDFIFEAAGNAWQYIKKDHAEWPLRFYAEVFSWACSVISAVIFAATVPTVPVIPLYTIFISGCCAAGWTCWTRGSFGLLANYVFLVTIDMIGLARMIVNT |
| ⦗Top⦘ |