Scaffold Ga0216346_10410874

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0216346_10410874

Scaffold Ga0216346_10410874

Overview

Basic Information
Taxon OID	3300022589 Open in IMG/M
Scaffold ID	Ga0216346_10410874 Open in IMG/M
Source Dataset Name	Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Bagasse, Gen0, Rep 2, Chloramphenicol (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	831
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.4148	Long. (^o)	-119.8405	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083484	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0216346_104108741	F083484	GGAGG	MKKLLSMILSILMIIPLCISGVSAEENDISKFELTAPKAPNYFVYTDGDASEGHHDDLRMIMVADPEVALLAAEY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.