| Basic Information | |
|---|---|
| Taxon OID | 3300022563 Open in IMG/M |
| Scaffold ID | Ga0212128_10963293 Open in IMG/M |
| Source Dataset Name | OV2_combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 501 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Beatty, NV | |||||||
| Coordinates | Lat. (o) | 36.96 | Long. (o) | -116.72 | Alt. (m) | Depth (m) | 10 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003926 | Metagenome / Metatranscriptome | 461 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0212128_109632931 | F003926 | N/A | LMRSESRASLTPRMEEAVNELKSLITERFPQATFVVEEGFDPKGTYLVTTVDIADTDEVMDVVGDRLVELQVTEGLPLYVTPLRPIERVVAQLREQEQATLPSPLPLT |
| ⦗Top⦘ |