Scaffold Ga0212128_10325047

Overview

Basic Information

• Taxon OID: 3300022563
• Scaffold ID: Ga0212128_10325047
• Source Dataset Name: OV2_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 962
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Beatty, NV
• Coordinates
  • Lat. (^o): 36.96
  • Long. (^o): -116.72
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058017	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212128_103250472	F058017	GGAGG	MDDDSRVIVSYTDAQALEDGVLVAFPGEGGANRVTRAVFDFFAKPLGSSPLTGPVTDITPVGDAIRAMLGVAPDADGWRTGSYRGKDLWLVPNEVGGLTLMFPDDY