Scaffold Ga0212128_10021910

Overview

Basic Information

• Taxon OID: 3300022563
• Scaffold ID: Ga0212128_10021910
• Source Dataset Name: OV2_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4109
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Beatty, NV
• Coordinates
  • Lat. (^o): 36.96
  • Long. (^o): -116.72
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005419	Metagenome / Metatranscriptome	401	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212128_100219103	F005419	AGGAGG	VAGGVAETLVEGKDSQPVRPGRGGRKPRNGHADGGEGLRFFLAKHGATDGVPNFEKEFGTEPEAIVESLKTGLSYYAISEWRGVADFSGKKPQLRREPVTRSRKTV