| Basic Information | |
|---|---|
| Taxon OID | 3300022557 Open in IMG/M |
| Scaffold ID | Ga0212123_10693629 Open in IMG/M |
| Source Dataset Name | Paint Pots_combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 628 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Banff, British Columbia | |||||||
| Coordinates | Lat. (o) | 51.1699 | Long. (o) | -116.1578 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012707 | Metagenome / Metatranscriptome | 278 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0212123_106936291 | F012707 | AGGAG | MTNKWSRMLMCVVLAGLTSAWAIAQDTDAQSKGEVRTITGCLSKGDNANEFLLTGTDGSTWEVHGNSAVNLAKHVGHTIEAKGVVSHNKMHNMKEDAKDAAKDSGMKNNNTEHGHLK |
| ⦗Top⦘ |