Scaffold Ga0212123_10173502

Overview

Basic Information

• Taxon OID: 3300022557
• Scaffold ID: Ga0212123_10173502
• Source Dataset Name: Paint Pots_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1632
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Canada: Banff, British Columbia
• Coordinates
  • Lat. (^o): 51.1699
  • Long. (^o): -116.1578

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069090	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212123_101735021	F069090	GGAG	MSFENWVKNSWLERLDSDAAEIARLLGLADRRLEDYERAVVGKLSPDVQLTLAYDAIRSSATAALRAAGPGRKRR