NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212123_10002857

Scaffold Ga0212123_10002857


Overview

Basic Information
Taxon OID3300022557 Open in IMG/M
Scaffold IDGa0212123_10002857 Open in IMG/M
Source Dataset NamePaint Pots_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)38971
Total Scaffold Genes43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)31 (72.09%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: Banff, British Columbia
CoordinatesLat. (o)51.1699Long. (o)-116.1578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008713Metagenome / Metatranscriptome329Y
F087468Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0212123_1000285715F087468AGGAGGMTSDSRLVLPLIESTDLSDEDKKLVKTILWRDGATPEITTPEQYVRYRRIAAQLARKYDAATRNSLSFIRSPDGVLLTSLEARMLAWEEDGEASSSSPG
Ga0212123_100028572F008713GGAMDQMELYKGFRIRAYQEWSGLWLAETKKPVRRRPGAGDHDDSDAEYIATPSGHPTPEAAIAFIKQMIDSPSTTIEAPKTIQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.