Scaffold Ga0212121_10018958

Overview

Basic Information

• Taxon OID: 3300022556
• Scaffold ID: Ga0212121_10018958
• Source Dataset Name: Kivu_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6417
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Rwanda: Lake Kivu
• Coordinates
  • Lat. (^o): -2.0288
  • Long. (^o): 29.1756
  • Depth (m): 325

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089118	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212121_1001895810	F089118	N/A	VTRLIWVILFAVLVGVLVVFSLRTMQTGTRLNQRLAGIQRARETMSGMFPDSRFRIQFSTPHPGVRNLVVTIQPGHPDSGTVARMVEAAESVARRKIDLTGYDSLVVAVFDSVYRSVPAR