| Basic Information | |
|---|---|
| Taxon OID | 3300022555 Open in IMG/M |
| Scaffold ID | Ga0212088_10142373 Open in IMG/M |
| Source Dataset Name | Alinen_combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2050 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Lake Alinen Mustajarvi | |||||||
| Coordinates | Lat. (o) | 61.5637 | Long. (o) | 22.044 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003520 | Metagenome / Metatranscriptome | 481 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0212088_101423732 | F003520 | AGG | MGITSPFQAQGKTYKANVTTASQVITVTSDSPCNQLCVSNHQPTGTGGQPVYFAVSNLANVTVAAPSPASPQYALVSVPGTIKVFTVPYQFSPNTNMYIAFIGEGTSECYFTPGEGV |
| ⦗Top⦘ |