Scaffold Ga0212093_1006285

Overview

Basic Information

• Taxon OID: 3300022554
• Scaffold ID: Ga0212093_1006285
• Source Dataset Name: Dewar_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15358
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (72.73%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 49.9543
  • Long. (^o): -116.5155

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029929	Metagenome	187	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212093_10062858	F029929	N/A	VPIFQQSVDSELYEWLLKEQKRRKARSIQDVIRQVLREAMAEAERHYG