| Basic Information | |
|---|---|
| Taxon OID | 3300022551 Open in IMG/M |
| Scaffold ID | Ga0212089_10343710 Open in IMG/M |
| Source Dataset Name | Boni_combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 690 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Indonesia: Gulf of Boni | |||||||
| Coordinates | Lat. (o) | -2.75 | Long. (o) | 121.05 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082076 | Metagenome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0212089_103437102 | F082076 | AGG | MQSGRKLVEHLLRKRELVLVRAVSSSQGRLAALKNLERAEKRFLLSFLASLTGGSYWLAMELWGLNVSDLLALPIHRVAAIILGAVVTATSLLAILAYL |
| ⦗Top⦘ |