NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212089_10301521

Scaffold Ga0212089_10301521


Overview

Basic Information
Taxon OID3300022551 Open in IMG/M
Scaffold IDGa0212089_10301521 Open in IMG/M
Source Dataset NameBoni_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)752
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameIndonesia: Gulf of Boni
CoordinatesLat. (o)-2.75Long. (o)121.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034800Metagenome173Y

Sequences

Protein IDFamilyRBSSequence
Ga0212089_103015211F034800N/AGLDVRILGPIFWAGLVNTVFLIFSLIRIFAAKGVRYGLLDLFNPRFYLANPIFIVLMIIGPVTFISDLMVFSAAGGVSTKTLGLIGLSALNLVGVIFAFAQFVLVNILFSTEHISSRVWILLLLWFILVVSGTLTGTVIMDELSR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.