Basic Information | |
---|---|
Taxon OID | 3300022551 Open in IMG/M |
Scaffold ID | Ga0212089_10109676 Open in IMG/M |
Source Dataset Name | Boni_combined assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1462 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Indonesia: Gulf of Boni | |||||||
Coordinates | Lat. (o) | -2.75 | Long. (o) | 121.05 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082076 | Metagenome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0212089_101096764 | F082076 | GAG | MKGTSRRTLLEHLLRRHALILTKAVSSHDRFAALKNLERAEKRFLLSFLTSLAGGIYWLTMELWGLNLNDIVKLPIHLVTSIVLGAAVTAASIMAILAYLSIGLVVQRAVEIKPRESDYG |
⦗Top⦘ |