Scaffold Ga0212089_10054096

Overview

Basic Information

• Taxon OID: 3300022551
• Scaffold ID: Ga0212089_10054096
• Source Dataset Name: Boni_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2322
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Desulfurococcales → Desulfurococcaceae → unclassified Desulfurococcaceae → Desulfurococcaceae archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Indonesia: Gulf of Boni
• Coordinates
  • Lat. (^o): -2.75
  • Long. (^o): 121.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054534	Metagenome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212089_100540963	F054534	N/A	LLYSQTANFLLEEKALAEKSGKDREYEEIVLKLGISNEYLKKLEQLIEVKRIFSSRAEAFRRALELLFEKYEETLRES