Scaffold Ga0212089_10000612

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212089_10000612

Scaffold Ga0212089_10000612

Overview

Basic Information
Taxon OID	3300022551 Open in IMG/M
Scaffold ID	Ga0212089_10000612 Open in IMG/M
Source Dataset Name	Boni_combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	26139
Total Scaffold Genes	25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	21 (84.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Indonesia: Gulf of Boni
Coordinates	Lat. (^o)	-2.75	Long. (^o)	121.05	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101429	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212089_1000061213	F101429	AGGA	MQGVRATFVLRKLRVLAALFLSLGVGAVIVGLILPAYKTPQTLTASGPKVPFTPERNYWIDFYLIPPIDEGRPITLTLVSSKPGSTWVYLGPFDIQTESISGPAVVNEMLGQNETGLVVFARATKSSAYSLRITSWNSTYSIRVQSTWSPYFEFRYGIVVGAGLIPASLLLLYYDGILEKRERMFQEAIKSAKKTASASGQDGLRQRLSY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.