| Basic Information | |
|---|---|
| Taxon OID | 3300022549 Open in IMG/M |
| Scaffold ID | Ga0212091_10020217 Open in IMG/M |
| Source Dataset Name | Cold Creek_combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2226 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cold Creek Source, Nevada | |||||||
| Coordinates | Lat. (o) | 36.41 | Long. (o) | -115.74 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079658 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0212091_100202172 | F079658 | N/A | MVIADIETDLLEYADFEEVASVSRARLFVTAANRWLILRAESASNQSSSLSIGKSYVENLLKRARDYVAANAETDSGAVGGVRFLGVGSDFR |
| ⦗Top⦘ |