Scaffold Ga0212119_1015258

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212119_1015258

Scaffold Ga0212119_1015258

Overview

Basic Information
Taxon OID	3300022543 Open in IMG/M
Scaffold ID	Ga0212119_1015258 Open in IMG/M
Source Dataset Name	Indian_combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1371
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	USA: Indian Creek, Illinois
Coordinates	Lat. (^o)	41.6655	Long. (^o)	-87.5437	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002935	Metagenome	519	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212119_10152583	F002935	AGGA	MRNRSKGYVGQIVDGKKLAVIANGIYNLQYSSNFSECTVDNLLFITLEEKNVFGDNKYALVCSEGVGWEQDTYGCLEVPTNIGQMGLWNGRVFISVDTVKECLTDQTEDIADYIRVFGDRLDRNCDLWQSKMSDPSVMIEV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.