| Basic Information | |
|---|---|
| Taxon OID | 3300022407 Open in IMG/M |
| Scaffold ID | Ga0181351_1150344 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 838 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 43.1881 | Long. (o) | -86.344 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059968 | Metagenome / Metatranscriptome | 133 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181351_11503441 | F059968 | AGGAG | MLLMKIKELRDAGNSISRTAQIMKMTRGTVQRWISEGQPEREVKKMDPYISFDDKTAIVIKWAELIANGASRTKAAETVGYPTMMLNRWLMSEPALRVEFQECVGKKQNNWGGRKSFEQILQPIRDGKAVQRDGARWKVQLVDSALMRYELDGANTWRCKGFATFSGPDVLAKDWTIIDE |
| ⦗Top⦘ |