Scaffold Ga0210374_1154473

Overview

Basic Information

• Taxon OID: 3300022391
• Scaffold ID: Ga0210374_1154473
• Source Dataset Name: Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: USA: Washington
• Coordinates
  • Lat. (^o): 46.313
  • Long. (^o): -123.997
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018837	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210374_11544731	F018837	AGGAG	MSTIFQELRKNYGAASAEQKLNILRRELLRPIVTVDTSAQLLQSASDSICECLTENISAEEFRNTIQWLTEAARDLHQILDALTEDTSQVQEQHGSG