| Basic Information | |
|---|---|
| Taxon OID | 3300022309 Open in IMG/M |
| Scaffold ID | Ga0224510_10762739 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 555 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 38.05 | Long. (o) | -121.934 | Alt. (m) | Depth (m) | 11 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023895 | Metagenome / Metatranscriptome | 208 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0224510_107627391 | F023895 | AGCAG | MNDRKNLAAPSGPPGSDGLSDTAVRRLKFGAASEGWEAYSSWLDKVRLQPSRASRQAVISKALYSVSSYKNWADKARGAFDDKK |
| ⦗Top⦘ |