| Basic Information | |
|---|---|
| Taxon OID | 3300022306 Open in IMG/M |
| Scaffold ID | Ga0224509_10189350 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 735 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 37.7 | Long. (o) | -122.34 | Alt. (m) | Depth (m) | 11 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054878 | Metagenome | 139 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0224509_101893502 | F054878 | AGGA | MTDLLKKFSAAAETLKSNNNPVRVCVYGAYREHLKDINPDDLLENIQIIYESVRDRLASVRPKGDIGEDEAGYLAKDILHMADVVKADYKRP |
| ⦗Top⦘ |