Scaffold Ga0187827_10393974

Overview

Basic Information

• Taxon OID: 3300022227
• Scaffold ID: Ga0187827_10393974
• Source Dataset Name: Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 861
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location

• Location Name: Pacific Ocean: Eastern Tropical North Pacific
• Coordinates
  • Lat. (^o): 18.2
  • Long. (^o): -104.2
  • Depth (m): 150

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028143	Metagenome	192	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0187827_103939741	F028143	N/A	CPLDIDPVEIGKLIAQVESLSNQIEESNRRLRAVEAQMERGRGMGLGILLATVGLSAGGASILTKWLN