Scaffold Ga0224512_10151030

Overview

Basic Information

• Taxon OID: 3300022226
• Scaffold ID: Ga0224512_10151030
• Source Dataset Name: Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1230
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.03
  • Long. (^o): -122.37
  • Depth (m): 9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094062	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224512_101510302	F094062	GGAGG	MEDEVKVIARMDRKKKVRLYHVLLDEGITFSEWLRRQIDDYLKEKEPKKSRGGGT