| Basic Information | |
|---|---|
| Taxon OID | 3300022225 Open in IMG/M |
| Scaffold ID | Ga0187833_10123129 Open in IMG/M |
| Source Dataset Name | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1622 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: Eastern Tropical North Pacific | |||||||
| Coordinates | Lat. (o) | 20.3333 | Long. (o) | -107.0 | Alt. (m) | Depth (m) | 400 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015660 | Metagenome | 253 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187833_101231292 | F015660 | N/A | MANTTKYSKELIDNIMKDLAEGMSIKASLKTHNLSWECFRKWLIDERKYPSLRAKYSQAKQDGIEYSLSDAQTLITEAVKDSKHKEKTDLGSTHLVKEFISLAKWRAEKLAPKVYGKKDNLTLLGDKNSPLIVKWK |
| ⦗Top⦘ |