Scaffold Ga0224505_10390811

Overview

Basic Information

• Taxon OID: 3300022214
• Scaffold ID: Ga0224505_10390811
• Source Dataset Name: Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 526
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SGD-2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.05
  • Long. (^o): -121.934
  • Depth (m): 11

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020691	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224505_103908111	F020691	N/A	LNSFFDSKTVREIRLLHLCDGIAASQIARDLGVNVSCISRIVNWKSWAHQDEDLRAIPKPNHKGGGDYHQLKPEGYVKPAPPQRLTCRSCLHLNSNTGVCDFGFPESLTSAYTFAAKCNVYQPTNNG